PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 472050
Common NameARALYDRAFT_472050, EPR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 355aa    MW: 39240.3 Da    PI: 6.927
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
472050genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-175094147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W++eE++++++a+k++G g W+ I +++g ++t+ q++s+ qk+
           472050 50 REKWSEEEHDRFLEAIKLYGRG-WRQIQEHIG-TKTAVQIRSHAQKF 94
                     789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.88E-164498IPR009057Homeodomain-like
PROSITE profilePS5129419.7684599IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-94696IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-164897IPR006447Myb domain, plants
SMARTSM007175.2E-134997IPR001005SANT/Myb domain
PfamPF002495.9E-155093IPR001005SANT/Myb domain
CDDcd001674.72E-115295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MAAEDRSEEL SSNVENGSCN SNEGTNPETS SHWIENIVKV RKPYTVTKQR EKWSEEEHDR  60
FLEAIKLYGR GWRQIQEHIG TKTAVQIRSH AQKFFSKMAQ EPDNRSEGSV KAVVIPPPRP  120
KRKPAHPYPR KSPVPYSQSP SSNLSAMEKG TKSPTSVLSS FASEDQINRC SSPNSCTSDI  180
QSIGATSIDK KNDYTTSKQS FKEDSDIGSI PMSSITLFGK IVLVVAESHD KPSSYRDDDD  240
PKSMTDQENH YSGIKNSSLH IDTNLSLGVW ETSCTSSNAF GSVTEVSENL EKSAEPISCS  300
WKQLSSLENQ GSCNPATASG FRPYKRCLSE REVTSSLSLV ASEEQNSQRR ARIC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1156960.0AB115696.1 Arabidopsis thaliana EPR1 mRNA for MYB-related transcription factor EPR1, complete cds.
GenBankAY0639520.0AY063952.1 Arabidopsis thaliana unknown protein (At1g18330) mRNA, complete cds.
GenBankAY1140700.0AY114070.1 Arabidopsis thaliana unknown protein (At1g18330) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892995.10.0early-phytochrome-responsive1
SwissprotB3H5A80.0RVE7_ARATH; Protein REVEILLE 7
TrEMBLD7KGC90.0D7KGC9_ARALL; Early-phytochrome-responsive1
STRINGfgenesh2_kg.1__2004__AT1G18330.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91742738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.10.0MYB_related family protein